PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr036939.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family GRAS
Protein Properties Length: 533aa    MW: 59264.5 Da    PI: 6.3666
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr036939.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS375.56.6e-1151605311374
         GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvs.elykalppsetsekn..sseelaalklfsevsPilkfsh 95 
                  lv+lL++cAeav+ +d++ a+alL +l+ +a   g+++qR+a++f+++La+rla  ++ + ++ +  s+ts+k+   +++  al+l +e++P ++f+h
  Pbr036939.1 160 LVQLLTACAEAVACRDKSHASALLYELRANALVFGSSFQRVASCFVQGLANRLALVQPlGAVRFI-GSATSTKDfaLDKKEEALRLVYEICPHIQFGH 256
                  689***************************************************95551444444.3344434456999999**************** PP

         GRAS  96 ltaNqaIleavegeervHiiDfdis....qGlQWpaLlqaLasRpegpp.slRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrled 188
                  ++aN+ Ilea+ege+ vH++D++++    +G QW  L+++La+R+++pp +lRiTgvg       ++l+ +ge L+ +A++lg+++ef+v v+++le+
  Pbr036939.1 257 FVANSSILEAFEGESFVHVVDLGMTlglpHGDQWRGLIESLATRTGQPPtRLRITGVGL----YGDRLQIIGEELEAYADSLGINLEFSV-VESNLEN 349
                  *********************99873333667*************88877*********....9*************************9.7****** PP

         GRAS 189 leleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvE 286
                  l++e++++  gE+l+Vn++lqlh +++es    +   +vL+++ +lsPk++v+veq+++hn++ Fl rf+eal+yysa+fdsl+a lp+ +  r+k+E
  Pbr036939.1 350 LRPEDIKMYDGEVLVVNSILQLHCVVKESRGALN---SVLQMLHELSPKILVLVEQDSSHNGPFFLGRFMEALHYYSAIFDSLDAMLPKYDTRRAKME 444
                  **************************88877777...8************************************************************ PP

         GRAS 287 rellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgWkdrpLvsvSaWr 374
                  ++++++ei+n+++ceg +r+erhe++ +Wr+r+++aGF++ p++  + +qak  l k+k  +gy++ ee+g+lvlgWk++p+v++S+W+
  Pbr036939.1 445 QFYFAEEIKNIISCEGPARVERHERVDQWRRRMSRAGFQATPFK--MLAQAKQWLGKIKvCEGYTILEEKGCLVLGWKSKPIVAASCWK 531
                  ******************************************96..678***************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098559.84134512IPR005202Transcription factor GRAS
PfamPF035142.3E-112160531IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 533 aa     Download sequence    Send to blast
MAPSRNFLPE EYMINHERTN KMSVLDLSTH SAASAMTCYP YLHTPLLEEG GTPSTPPYSD  60
ESGNHKRLKW TTSISDSMSS HNSLYSGGGS GDSCITDISL SRRSSTNSLN TLPRLHFRDH  120
IWTYTQRYLA AEAVEEAVTV MSNAEGNGKE EDGTADGMRL VQLLTACAEA VACRDKSHAS  180
ALLYELRANA LVFGSSFQRV ASCFVQGLAN RLALVQPLGA VRFIGSATST KDFALDKKEE  240
ALRLVYEICP HIQFGHFVAN SSILEAFEGE SFVHVVDLGM TLGLPHGDQW RGLIESLATR  300
TGQPPTRLRI TGVGLYGDRL QIIGEELEAY ADSLGINLEF SVVESNLENL RPEDIKMYDG  360
EVLVVNSILQ LHCVVKESRG ALNSVLQMLH ELSPKILVLV EQDSSHNGPF FLGRFMEALH  420
YYSAIFDSLD AMLPKYDTRR AKMEQFYFAE EIKNIISCEG PARVERHERV DQWRRRMSRA  480
GFQATPFKML AQAKQWLGKI KVCEGYTILE EKGCLVLGWK SKPIVAASCW KC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-481605314375GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009359535.10.0PREDICTED: DELLA protein RGL1-like
TrEMBLM5WBT20.0M5WBT2_PRUPE; Uncharacterized protein
STRINGPOPTR_0015s10310.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF87302945
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66350.12e-80RGA-like 1